CABS-dock: 99de8c155d71c4a

Project name: 99de8c155d71c4a

Status: done

submitted: 2025-12-30 15:29:27, status changed: 2025-12-30 21:38:21

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVIVQCGSNSFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.089	2.86172	27.2649	109
cluster_2.pdb ( medoid)	30.7697	3.63994	35.1897	112
cluster_3.pdb ( medoid)	18.1773	7.53688	26.5227	137
cluster_4.pdb ( medoid)	10.1493	9.36025	30.9002	95
cluster_5.pdb ( medoid)	9.04712	16.8009	46.0412	152
cluster_6.pdb ( medoid)	7.19215	11.1232	31.4322	80
cluster_7.pdb ( medoid)	7.00695	14.557	33.7471	102
cluster_8.pdb ( medoid)	5.70634	13.8443	34.7057	79
cluster_9.pdb ( medoid)	5.07765	13.392	40.1601	68
cluster_10.pdb ( medoid)	4.26663	15.4689	38.6719	66