Project name: 9a4cdabc4f40784

Status: done

submitted: 2026-02-18 11:42:08, status changed: 2026-02-18 15:49:24

Project settings
Protein sequence(s) IRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS input pdb
Peptide sequence EYEEEEEVEEEVEEEVEEEVEEEK
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 15.8381 6.12446 28.1877 97
cluster_2.pdb ( medoid) 15.0139 4.19611 7.94343 63
cluster_3.pdb ( medoid) 14.1604 8.05061 23.095 114
cluster_4.pdb ( medoid) 13.8035 15.2135 37.0849 210
cluster_5.pdb ( medoid) 8.46551 10.0407 20.8077 85
cluster_6.pdb ( medoid) 8.27802 14.7378 33.4067 122
cluster_7.pdb ( medoid) 6.80833 12.7785 38.2821 87
cluster_8.pdb ( medoid) 4.88582 5.52619 11.6511 27
cluster_9.pdb ( medoid) 4.10121 11.9477 23.3905 49
cluster_10.pdb ( medoid) 3.5279 13.0389 32.5029 46