Project name: 9a508047aa7f999

Status: done

submitted: 2026-07-16 14:02:24, status changed: 2026-07-16 16:27:48

Project settings
Protein sequence(s) LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence VLGYMQLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 72.2329 2.78267 15.8219 201
cluster_2.pdb ( medoid) 37.7894 3.91644 16.8858 148
cluster_3.pdb ( medoid) 25.8879 3.78555 10.6229 98
cluster_4.pdb ( medoid) 21.8191 6.96638 22.0738 152
cluster_5.pdb ( medoid) 19.2104 1.76987 7.16108 34
cluster_6.pdb ( medoid) 18.7879 8.67581 34.6643 163
cluster_7.pdb ( medoid) 15.3846 4.48502 11.466 69
cluster_8.pdb ( medoid) 7.095 4.7921 10.1122 34
cluster_9.pdb ( medoid) 6.93916 8.50247 22.0023 59
cluster_10.pdb ( medoid) 4.09021 10.2684 24.113 42