Project name: 1le0

Status: done

submitted: 2025-12-12 13:46:04, status changed: 2025-12-12 17:35:53

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence SWTWEGNKWTWK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.4309 10.5416 30.7677 247
cluster_2.pdb ( medoid) 19.7714 4.95666 20.3009 98
cluster_3.pdb ( medoid) 18.1906 4.28792 23.6368 78
cluster_4.pdb ( medoid) 17.5731 3.98337 14.5442 70
cluster_5.pdb ( medoid) 15.0641 8.49702 27.0353 128
cluster_6.pdb ( medoid) 8.23303 12.2677 32.8192 101
cluster_7.pdb ( medoid) 7.31558 9.56862 24.3666 70
cluster_8.pdb ( medoid) 6.82948 11.2747 33.0788 77
cluster_9.pdb ( medoid) 5.31874 15.9812 36.4096 85
cluster_10.pdb ( medoid) 3.43859 13.3776 25.6319 46