CABS-dock: 9ade52514411068

Project name: 9ade52514411068

Status: done

submitted: 2026-01-20 05:54:06, status changed: 2026-01-20 09:09:26

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPALPPTDESIKYTIYNSTGIQIGAYNYMEIGGMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIFVQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.805	6.37468	26.0184	139
cluster_2.pdb ( medoid)	20.7693	5.72962	29.4875	119
cluster_3.pdb ( medoid)	13.7465	9.67518	31.6566	133
cluster_4.pdb ( medoid)	13.5116	10.0654	24.6933	136
cluster_5.pdb ( medoid)	13.0307	10.2834	36.6332	134
cluster_6.pdb ( medoid)	8.98216	13.0258	32.2598	117
cluster_7.pdb ( medoid)	8.79859	9.7743	33.1328	86
cluster_8.pdb ( medoid)	4.65595	10.7389	27.0165	50
cluster_9.pdb ( medoid)	4.38715	11.169	30.238	49
cluster_10.pdb ( medoid)	2.51247	14.7265	29.6264	37