CABS-dock: 9b312a074f6d986

Project name: 9b312a074f6d986

Status: done

submitted: 2026-06-14 08:20:54, status changed: 2026-06-14 11:57:40

Project settings

Protein sequence(s)	MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE input pdb
Peptide sequence	TVGDVNTDRPGLLDL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	63.4591	1.27641	8.48806	81
cluster_2.pdb ( medoid)	23.2407	4.86216	26.9955	113
cluster_3.pdb ( medoid)	16.4211	9.13457	33.0639	150
cluster_4.pdb ( medoid)	14.6521	10.1009	28.395	148
cluster_5.pdb ( medoid)	13.7053	8.75571	26.7593	120
cluster_6.pdb ( medoid)	12.1864	8.86236	25.5055	108
cluster_7.pdb ( medoid)	12.16	8.38814	27.911	102
cluster_8.pdb ( medoid)	9.12599	12.0535	31.4356	110
cluster_9.pdb ( medoid)	6.0774	6.91085	21.1865	42
cluster_10.pdb ( medoid)	2.0691	12.5658	27.1365	26