CABS-dock: CDK5-DRP1-11

Project name: CDK5-DRP1-11

Status: done

submitted: 2026-06-23 08:39:28, status changed: 2026-06-24 06:52:45

Project settings

Protein sequence(s)

QKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSSTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES input pdb

Peptide sequence

PIMPASPQK

Simulation mc cycles

100

Peptide secondary structure psipred

CCCCCCCCC

Flexible regions

132:A - 139:A

25:A - 31:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	91.777	0.664654	5.52982	61
cluster_2.pdb ( medoid)	36.6357	7.72472	38.9915	283
cluster_3.pdb ( medoid)	27.2904	4.03072	29.6656	110
cluster_4.pdb ( medoid)	22.6052	1.99069	23.3513	45
cluster_5.pdb ( medoid)	15.4818	9.7534	27.973	151
cluster_6.pdb ( medoid)	11.7566	8.59089	28.216	101
cluster_7.pdb ( medoid)	7.24059	14.3635	37.7609	104
cluster_8.pdb ( medoid)	6.67349	10.4893	31.1338	70
cluster_9.pdb ( medoid)	3.79364	13.18	27.6984	50
cluster_10.pdb ( medoid)	1.60692	15.5577	35.8207	25