CABS-dock: 9c8c9c65cc6cb44

Project name: 9c8c9c65cc6cb44

Status: done

submitted: 2026-03-09 05:00:27, status changed: 2026-03-09 07:31:45

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDNTA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.5703	7.32488	33.7332	158
cluster_2.pdb ( medoid)	12.6394	9.88973	48.0336	125
cluster_3.pdb ( medoid)	10.7297	8.3879	18.2749	90
cluster_4.pdb ( medoid)	10.4876	9.43968	23.6313	99
cluster_5.pdb ( medoid)	9.90038	9.49459	28.6497	94
cluster_6.pdb ( medoid)	8.24696	11.8832	28.8004	98
cluster_7.pdb ( medoid)	7.9898	13.7676	39.2812	110
cluster_8.pdb ( medoid)	5.96916	15.4126	42.6659	92
cluster_9.pdb ( medoid)	5.34214	11.4186	29.2724	61
cluster_10.pdb ( medoid)	4.75641	15.3477	39.3458	73