CABS-dock: 260628_LepB_3T

Project name: 260628_LepB_3T_1

Status: done

submitted: 2026-06-28 04:11:37, status changed: 2026-06-28 08:17:19

Project settings

Protein sequence(s)	RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence	MLSFAADTTT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.555	5.72745	30.1659	112
cluster_2.pdb ( medoid)	19.1189	6.2242	31.9394	119
cluster_3.pdb ( medoid)	17.0897	6.49515	27.0843	111
cluster_4.pdb ( medoid)	15.065	5.17755	15.9486	78
cluster_5.pdb ( medoid)	14.1301	9.55409	36.6305	135
cluster_6.pdb ( medoid)	13.4621	7.50252	32.1444	101
cluster_7.pdb ( medoid)	11.8558	14.339	43.5602	170
cluster_8.pdb ( medoid)	11.3423	10.4036	28.8117	118
cluster_9.pdb ( medoid)	5.56177	6.11316	22.9781	34
cluster_10.pdb ( medoid)	4.08033	5.39172	16.16	22