CABS-dock: 2nc7

Project name: 2nc7

Status: done

submitted: 2025-12-12 16:11:43, status changed: 2025-12-12 19:38:14

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	RGGRLCYCRPRFCVCVGR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEECCCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.6987	5.05863	22.0492	130
cluster_2.pdb ( medoid)	22.0512	5.26049	21.2104	116
cluster_3.pdb ( medoid)	17.209	7.72851	34.2591	133
cluster_4.pdb ( medoid)	16.1214	9.49051	34.8127	153
cluster_5.pdb ( medoid)	14.3216	6.00493	26.9397	86
cluster_6.pdb ( medoid)	13.8359	9.32356	31.2234	129
cluster_7.pdb ( medoid)	11.5151	10.5948	30.566	122
cluster_8.pdb ( medoid)	5.20586	10.9492	26.8912	57
cluster_9.pdb ( medoid)	4.25631	12.2172	24.2623	52
cluster_10.pdb ( medoid)	1.85513	11.859	23.6809	22