Project name: Nirbhay-V8_protease-Pteroicidin-Alpha-DOCK

Status: done

submitted: 2025-06-21 17:26:14, status changed: 2025-06-21 21:03:25

Project settings
Protein sequence(s) VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA input pdb
Peptide sequence FIHHIIGGLFHVGKSIHDLIR
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHCHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.9067 3.70949 14.0448 174
cluster_2.pdb ( medoid) 26.6389 5.89364 36.9465 157
cluster_3.pdb ( medoid) 17.9713 7.51196 37.6378 135
cluster_4.pdb ( medoid) 8.46733 11.1015 30.2907 94
cluster_5.pdb ( medoid) 7.03211 9.38552 28.4744 66
cluster_6.pdb ( medoid) 6.86881 16.0144 39.9754 110
cluster_7.pdb ( medoid) 6.61835 14.5051 32.7053 96
cluster_8.pdb ( medoid) 5.72179 10.3115 24.5704 59
cluster_9.pdb ( medoid) 5.03109 12.5221 42.2007 63
cluster_10.pdb ( medoid) 2.28098 20.1668 41.7335 46