CABS-dock: 9dc8652a4555ab

Project name: 9dc8652a4555ab

Status: done

submitted: 2026-02-26 17:20:20, status changed: 2026-02-27 00:03:05

Project settings

Protein sequence(s)	MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK input pdb
Peptide sequence	KKWLALWLKE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	82.5144	1.23615	7.45358	102
cluster_2.pdb ( medoid)	31.8757	3.13718	8.73349	100
cluster_3.pdb ( medoid)	25.0264	5.15456	10.1151	129
cluster_4.pdb ( medoid)	21.4743	5.35525	17.3787	115
cluster_5.pdb ( medoid)	21.4008	4.57927	10.0336	98
cluster_6.pdb ( medoid)	8.91916	4.59685	7.98484	41
cluster_7.pdb ( medoid)	8.41761	8.3159	21.0822	70
cluster_8.pdb ( medoid)	2.48925	6.0259	11.1486	15
cluster_9.pdb ( medoid)	1.75185	10.2749	19.864	18
cluster_10.pdb ( medoid)	1.10904	10.8201	18.4419	12