Project name: 9dc8652a4555ab

Status: done

submitted: 2026-02-26 17:20:20, status changed: 2026-02-27 00:03:05

Project settings
Protein sequence(s) MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK input pdb
Peptide sequence KKWLALWLKE
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 82.5144 1.23615 7.45358 102
cluster_2.pdb ( medoid) 31.8757 3.13718 8.73349 100
cluster_3.pdb ( medoid) 25.0264 5.15456 10.1151 129
cluster_4.pdb ( medoid) 21.4743 5.35525 17.3787 115
cluster_5.pdb ( medoid) 21.4008 4.57927 10.0336 98
cluster_6.pdb ( medoid) 8.91916 4.59685 7.98484 41
cluster_7.pdb ( medoid) 8.41761 8.3159 21.0822 70
cluster_8.pdb ( medoid) 2.48925 6.0259 11.1486 15
cluster_9.pdb ( medoid) 1.75185 10.2749 19.864 18
cluster_10.pdb ( medoid) 1.10904 10.8201 18.4419 12