Project name: 9e7e0a2ca18d344

Status: done

submitted: 2026-03-15 13:40:23, status changed: 2026-03-15 16:59:32

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RQIKIWFQNRRMKWKKGGVQVFGSNTY
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEECCCCCEEECCEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.7016 5.15383 28.7908 117
cluster_2.pdb ( medoid) 19.7769 5.916 20.8935 117
cluster_3.pdb ( medoid) 18.2304 8.00861 32.0418 146
cluster_4.pdb ( medoid) 9.96621 13.5458 31.1217 135
cluster_5.pdb ( medoid) 9.21711 7.0521 26.4325 65
cluster_6.pdb ( medoid) 7.44898 14.0959 30.9734 105
cluster_7.pdb ( medoid) 6.41101 14.8182 30.2569 95
cluster_8.pdb ( medoid) 5.40479 12.5814 24.9434 68
cluster_9.pdb ( medoid) 5.37056 16.758 37.3528 90
cluster_10.pdb ( medoid) 4.75394 13.0418 28.934 62