Project name: hnrnpab_chensinin1b_blind_1

Status: done

submitted: 2026-03-13 05:04:21, status changed: 2026-03-13 13:10:09

Project settings
Protein sequence(s) KNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKE input pdb
Peptide sequence SKVWRHWRRFWHRAHRKL
Simulation mc cycles100
Peptide secondary structure psipred CHHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 60.5607 2.2787 7.54873 138
cluster_2.pdb ( medoid) 35.4824 1.38097 7.47311 49
cluster_3.pdb ( medoid) 18.1432 11.2439 42.8208 204
cluster_4.pdb ( medoid) 17.3896 10.811 35.2149 188
cluster_5.pdb ( medoid) 16.0006 1.99993 7.87143 32
cluster_6.pdb ( medoid) 14.9162 9.45283 24.6997 141
cluster_7.pdb ( medoid) 14.1474 3.11012 5.63786 44
cluster_8.pdb ( medoid) 7.70857 8.95108 15.5155 69
cluster_9.pdb ( medoid) 7.0378 12.7881 33.2703 90
cluster_10.pdb ( medoid) 5.61249 8.01784 20.437 45