CABS-dock: braf_monomer_peptide

Project name: braf_monomer_peptide_8

Status: done

submitted: 2025-12-28 10:30:57, status changed: 2025-12-28 17:29:10

Project settings

Protein sequence(s)	DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence	RKTRHVNILLFM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	58.6251	2.71215	24.2094	159
cluster_2.pdb ( medoid)	38.5767	2.22933	11.0069	86
cluster_3.pdb ( medoid)	16.5802	6.1519	24.9837	102
cluster_4.pdb ( medoid)	14.7573	10.3	47.0147	152
cluster_5.pdb ( medoid)	13.5161	5.40097	23.824	73
cluster_6.pdb ( medoid)	11.3915	11.0609	35.7954	126
cluster_7.pdb ( medoid)	10.2123	14.0027	29.5545	143
cluster_8.pdb ( medoid)	8.00123	9.99847	40.8745	80
cluster_9.pdb ( medoid)	4.11313	15.0737	33.7213	62
cluster_10.pdb ( medoid)	1.51169	11.2457	28.8004	17