Project name: 9ef026077873e11

Status: done

submitted: 2026-03-08 14:24:22, status changed: 2026-03-08 17:10:53

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQLFGSNCW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.2162 6.82785 22.5214 179
cluster_2.pdb ( medoid) 25.0416 3.31449 18.774 83
cluster_3.pdb ( medoid) 20.2462 7.16182 27.1782 145
cluster_4.pdb ( medoid) 16.1985 9.93918 27.9219 161
cluster_5.pdb ( medoid) 8.87953 10.2483 22.9532 91
cluster_6.pdb ( medoid) 7.41853 12.8058 26.3687 95
cluster_7.pdb ( medoid) 7.40331 8.10448 31.5557 60
cluster_8.pdb ( medoid) 6.84475 7.01268 20.1427 48
cluster_9.pdb ( medoid) 6.09195 13.2962 32.4582 81
cluster_10.pdb ( medoid) 4.99116 11.4202 19.4345 57