Project name: RecA-Cs8

Status: done

submitted: 2026-01-10 14:52:52, status changed: 2026-01-10 18:08:01

Project settings
Protein sequence(s) EGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVVIRNGDWL input pdb
Peptide sequence IVKVQANQHKHIAGLKE
Simulation mc cycles50
Peptide secondary structure psipred CCEEECCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.7144 4.40205 21.0995 122
cluster_2.pdb ( medoid) 23.9001 4.97905 11.0292 119
cluster_3.pdb ( medoid) 20.5593 9.48477 38.1283 195
cluster_4.pdb ( medoid) 10.0456 8.1628 24.3772 82
cluster_5.pdb ( medoid) 8.09836 12.3482 26.4879 100
cluster_6.pdb ( medoid) 7.81764 7.41912 23.7338 58
cluster_7.pdb ( medoid) 7.21455 15.6628 40.976 113
cluster_8.pdb ( medoid) 6.48327 7.55792 25.372 49
cluster_9.pdb ( medoid) 6.17561 11.8207 27.6463 73
cluster_10.pdb ( medoid) 6.06556 14.673 36.8105 89