CABS-dock: 2O2F-SGPPGLPGPIGLPGDPG

Project name: 2O2F-SGPPGLPGPIGLPGDPG

Status: done

submitted: 2025-08-25 08:32:31, status changed: 2025-08-25 10:56:04

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	SGPPGLPGPIGLPGDPG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.4041	7.80294	30.6909	128
cluster_2.pdb ( medoid)	14.4659	8.29539	37.1301	120
cluster_3.pdb ( medoid)	13.4384	8.25988	25.1806	111
cluster_4.pdb ( medoid)	10.9457	10.8719	29.3734	119
cluster_5.pdb ( medoid)	7.92155	12.4976	40.2207	99
cluster_6.pdb ( medoid)	7.44168	15.3191	47.8217	114
cluster_7.pdb ( medoid)	6.30953	15.3736	49.4187	97
cluster_8.pdb ( medoid)	5.81038	15.6616	34.115	91
cluster_9.pdb ( medoid)	4.40466	11.3516	30.4985	50
cluster_10.pdb ( medoid)	3.8663	18.3638	38.8557	71