Project name: VKACPGGY

Status: done

submitted: 2026-02-17 15:16:14, status changed: 2026-02-18 03:47:14

Project settings
Protein sequence(s) GSHSSMMRYFFTSSVSRPGRGEEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHHSSQTHRVDLGTLLRGYYNQSEAGSHTVQRRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKKHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQQRTDAPKKTHMTHHAVSDHEATLRCWALSSFYPPAEITLTTWQRRDGEDQTQDTELVEETRPAGDGTFQKKWAAVVVVPSSGQEQRYTCHVQHEGLPKPLTLRWQRRTPPKIQVVYSRHPAENGKSSNFLNCYVVSGFHPSDDIEVDLLKNGERIEKKVEHSDLSFSSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDDRD input pdb
Peptide sequence VKACPGGY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 49.3548 1.45883 5.87529 72
cluster_2.pdb ( medoid) 41.3278 2.61325 9.87148 108
cluster_3.pdb ( medoid) 36.514 2.87561 10.9879 105
cluster_4.pdb ( medoid) 27.0226 2.92347 15.8613 79
cluster_5.pdb ( medoid) 19.7555 5.66931 22.9113 112
cluster_6.pdb ( medoid) 15.1259 8.39619 45.4565 127
cluster_7.pdb ( medoid) 13.4983 13.8536 44.187 187
cluster_8.pdb ( medoid) 9.82664 11.8046 41.2098 116
cluster_9.pdb ( medoid) 4.61667 14.5126 33.8562 67
cluster_10.pdb ( medoid) 2.76677 9.75866 23.9705 27