Project name: Trail_193_to_206_

Status: done

submitted: 2025-12-26 17:34:28, status changed: 2025-12-26 22:02:07

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence QEEIKENTKNDKQMV
Simulation mc cycles100
Peptide secondary structure psipred CHHHHHHCHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.2396 8.79465 26.3008 178
cluster_2.pdb ( medoid) 18.4618 6.6624 32.6856 123
cluster_3.pdb ( medoid) 13.2509 7.84855 16.9082 104
cluster_4.pdb ( medoid) 13.0643 11.1755 28.7552 146
cluster_5.pdb ( medoid) 9.50955 8.72807 25.312 83
cluster_6.pdb ( medoid) 9.0165 8.5399 22.237 77
cluster_7.pdb ( medoid) 7.83589 8.29516 24.5253 65
cluster_8.pdb ( medoid) 7.54863 7.68352 20.4101 58
cluster_9.pdb ( medoid) 7.43244 13.1854 29.147 98
cluster_10.pdb ( medoid) 4.85257 14.0132 27.8317 68