CABS-dock: a1d59328b2d3c17

Project name: a1d59328b2d3c17

Status: done

submitted: 2026-01-21 16:25:57, status changed: 2026-01-21 19:43:43

Project settings

Protein sequence(s)	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence	QQYGSSPWT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.9866	2.60087	11.0014	104
cluster_2.pdb ( medoid)	35.1155	3.18948	12.4026	112
cluster_3.pdb ( medoid)	29.7841	6.84929	32.4919	204
cluster_4.pdb ( medoid)	21.4745	4.51699	12.3081	97
cluster_5.pdb ( medoid)	18.2051	7.08591	27.5953	129
cluster_6.pdb ( medoid)	14.2057	9.50322	21.7234	135
cluster_7.pdb ( medoid)	10.9467	5.02433	12.9492	55
cluster_8.pdb ( medoid)	9.97981	9.81982	26.015	98
cluster_9.pdb ( medoid)	4.65439	9.45343	17.3227	44
cluster_10.pdb ( medoid)	2.10072	10.4726	19.6065	22