Project name: a27d23a7e3c667e

Status: done

submitted: 2025-08-25 18:38:35, status changed: 2025-08-25 20:10:51

Project settings
Protein sequence(s) VVQVNDSMYGFIGTDVVLHCSFANKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAK input pdb
Peptide sequence QRTVAVYSLRIAGFHG
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.2056 2.92567 15.7768 103
cluster_2.pdb ( medoid) 25.367 7.25352 21.9932 184
cluster_3.pdb ( medoid) 19.3142 8.0252 25.6743 155
cluster_4.pdb ( medoid) 15.9961 8.18952 22.6631 131
cluster_5.pdb ( medoid) 15.0672 7.89794 26.0359 119
cluster_6.pdb ( medoid) 13.4863 6.59928 20.5132 89
cluster_7.pdb ( medoid) 9.21195 5.97051 12.5097 55
cluster_8.pdb ( medoid) 8.57598 6.99628 17.224 60
cluster_9.pdb ( medoid) 6.86176 7.8697 23.6939 54
cluster_10.pdb ( medoid) 4.16945 11.992 28.0025 50