Project name: N-TNA-6

Status: done

submitted: 2025-07-28 08:13:13, status changed: 2025-07-30 00:35:50

Project settings
Protein sequence(s) ASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKT input pdb
Peptide sequence KYVFINVCHRV
Simulation mc cycles150
Peptide secondary structure psipred CEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 71.7867 2.75817 10.0124 198
cluster_2.pdb ( medoid) 47.648 3.63079 22.2611 173
cluster_3.pdb ( medoid) 44.3389 3.29282 41.3662 146
cluster_4.pdb ( medoid) 25.2 4.12698 30.5904 104
cluster_5.pdb ( medoid) 18.5897 4.03448 8.57362 75
cluster_6.pdb ( medoid) 16.3203 4.96314 14.5705 81
cluster_7.pdb ( medoid) 9.18679 9.47012 32.1036 87
cluster_8.pdb ( medoid) 3.65782 13.1226 51.2734 48
cluster_9.pdb ( medoid) 2.64957 15.4742 41.0897 41
cluster_10.pdb ( medoid) 2.49034 18.8729 48.7597 47