Project name: a29d01e478e0bc2

Status: done

submitted: 2026-03-08 14:17:30, status changed: 2026-03-09 02:04:39

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence VQVFGLNNY
Simulation mc cycles50
Peptide secondary structure psipred CCEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.0831 5.34225 21.1162 134
cluster_2.pdb ( medoid) 18.9002 9.36497 38.7535 177
cluster_3.pdb ( medoid) 17.0226 6.52074 21.4883 111
cluster_4.pdb ( medoid) 10.27 9.2502 19.631 95
cluster_5.pdb ( medoid) 10.1984 9.21714 34.2934 94
cluster_6.pdb ( medoid) 9.50828 9.25509 38.2911 88
cluster_7.pdb ( medoid) 8.51119 8.69444 30.6733 74
cluster_8.pdb ( medoid) 8.41434 14.0237 39.7663 118
cluster_9.pdb ( medoid) 7.06049 11.8972 25.8084 84
cluster_10.pdb ( medoid) 2.51078 9.95708 17.8786 25