Project name: a2eb80e92ed7d5a

Status: done

submitted: 2025-12-27 10:21:03, status changed: 2025-12-27 17:01:24

Project settings
Protein sequence(s) RSVASSSKLWMLLEFSAFLEQQQDPDTYNKHLFVHIGLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNGSSFYGVSSQYEESSPENNMIITTCSTKVCSFGKQVVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSSVLENFTILQVVTTNRDTQETLLCIAYVVFEVSASEHGAQHHIYRLVKEDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPP input pdb
Peptide sequence GLFDIIKKIAESF
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.6392 8.36067 47.0033 206
cluster_2.pdb ( medoid) 19.5099 7.07335 36.3058 138
cluster_3.pdb ( medoid) 18.8488 6.4195 35.578 121
cluster_4.pdb ( medoid) 12.3133 3.57337 17.5785 44
cluster_5.pdb ( medoid) 12.0948 10.087 29.207 122
cluster_6.pdb ( medoid) 9.62069 10.0824 26.4386 97
cluster_7.pdb ( medoid) 8.67617 12.5631 37.417 109
cluster_8.pdb ( medoid) 5.78727 11.9227 30.6025 69
cluster_9.pdb ( medoid) 3.75725 15.703 36.5805 59
cluster_10.pdb ( medoid) 2.55336 13.7074 31.936 35