CABS-dock: a3a57280a2c8f9a

Project name: a3a57280a2c8f9a

Status: done

submitted: 2026-01-20 07:42:51, status changed: 2026-01-20 09:47:30

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIVFQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	54.7718	3.54197	20.0528	194
cluster_2.pdb ( medoid)	24.32	4.31744	22.8842	105
cluster_3.pdb ( medoid)	17.1031	6.08078	28.5567	104
cluster_4.pdb ( medoid)	12.4608	7.14242	17.6362	89
cluster_5.pdb ( medoid)	10.8617	8.37809	25.3798	91
cluster_6.pdb ( medoid)	10.0166	11.1814	23.3978	112
cluster_7.pdb ( medoid)	9.64705	12.2317	30.2053	118
cluster_8.pdb ( medoid)	7.72964	11.5141	31.0991	89
cluster_9.pdb ( medoid)	7.43239	7.13095	17.0171	53
cluster_10.pdb ( medoid)	3.71269	12.1206	34.4325	45