Project name: a3aea2b26f834a1

Status: done

submitted: 2026-03-19 13:43:32, status changed: 2026-03-19 17:52:27

Project settings
Protein sequence(s) NVKYNFMRIIKYEFILNDALNQSIIRANAQYLTAAALHNLDEAVKFDMGAYKSSAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE input pdb
Peptide sequence DHLSDNYTLDHDRAIH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.8454 4.13478 22.8004 111
cluster_2.pdb ( medoid) 20.6347 4.6039 18.1264 95
cluster_3.pdb ( medoid) 17.9075 7.92965 26.6342 142
cluster_4.pdb ( medoid) 16.1622 7.91971 22.5497 128
cluster_5.pdb ( medoid) 14.9545 7.89062 21.7263 118
cluster_6.pdb ( medoid) 12.6529 6.87589 23.4174 87
cluster_7.pdb ( medoid) 8.66794 15.4593 38.2258 134
cluster_8.pdb ( medoid) 5.81935 11.857 24.0321 69
cluster_9.pdb ( medoid) 4.30509 15.3307 30.3911 66
cluster_10.pdb ( medoid) 2.82218 17.7168 35.4406 50