Project name: braf_monomer_peptide_7_new

Status: done

submitted: 2026-01-16 17:27:06, status changed: 2026-01-17 02:32:39

Project settings
Protein sequence(s) DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence KTRHVNILLFM
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.9717 2.33449 6.11632 133
cluster_2.pdb ( medoid) 37.9846 2.81693 12.9199 107
cluster_3.pdb ( medoid) 28.2014 5.31888 11.0373 150
cluster_4.pdb ( medoid) 20.0812 5.27857 17.6948 106
cluster_5.pdb ( medoid) 15.3258 9.39589 26.5484 144
cluster_6.pdb ( medoid) 13.7841 7.39982 27.766 102
cluster_7.pdb ( medoid) 12.6783 8.9129 31.2316 113
cluster_8.pdb ( medoid) 6.65056 9.0218 31.4258 60
cluster_9.pdb ( medoid) 3.42347 12.8524 31.8663 44
cluster_10.pdb ( medoid) 2.7805 14.7456 34.3107 41