Project name: HMVRMFRQWVFV

Status: done

submitted: 2026-04-02 10:03:12, status changed: 2026-04-02 10:32:31

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence HMVRMFRQWVFV
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.0745 1.84139 11.4164 83
cluster_2.pdb ( medoid) 39.339 3.02499 14.5308 119
cluster_3.pdb ( medoid) 18.2903 5.63139 22.4274 103
cluster_4.pdb ( medoid) 17.494 6.05922 27.5711 106
cluster_5.pdb ( medoid) 15.0237 14.2441 35.6676 214
cluster_6.pdb ( medoid) 13.8795 10.8794 44.9779 151
cluster_7.pdb ( medoid) 11.8374 5.40661 23.0063 64
cluster_8.pdb ( medoid) 5.40418 19.0593 41.5093 103
cluster_9.pdb ( medoid) 2.58974 14.6733 41.4498 38
cluster_10.pdb ( medoid) 1.58754 11.9682 32.2515 19