CABS-dock: a5b1ac073f3c351

Project name: a5b1ac073f3c351

Status: done

submitted: 2026-01-11 16:14:03, status changed: 2026-01-11 19:48:30

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATLPPTDESIKYTIYNSTGIQIGAYNYMEIGGMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIVQVGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.285	5.13102	19.1069	140
cluster_2.pdb ( medoid)	21.3659	5.14838	22.8866	110
cluster_3.pdb ( medoid)	18.1107	5.30072	20.4442	96
cluster_4.pdb ( medoid)	16.715	6.99971	24.7564	117
cluster_5.pdb ( medoid)	16.5502	8.70083	27.1719	144
cluster_6.pdb ( medoid)	8.98583	11.5738	25.0949	104
cluster_7.pdb ( medoid)	8.04048	10.6959	23.6528	86
cluster_8.pdb ( medoid)	6.96843	13.7764	28.3992	96
cluster_9.pdb ( medoid)	6.33205	12.4762	27.1984	79
cluster_10.pdb ( medoid)	4.92814	5.68165	22.3346	28