Project name: Pepm-Met-Unbiased

Status: done

submitted: 2025-06-22 18:51:19, status changed: 2025-06-22 22:54:49

Project settings
Protein sequence(s) AGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG input pdb
Peptide sequence LPLSGGIKYPVYNHD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.1145 4.23269 21.1582 119
cluster_2.pdb ( medoid) 19.6029 9.38636 30.9573 184
cluster_3.pdb ( medoid) 17.5604 7.45996 25.7994 131
cluster_4.pdb ( medoid) 15.5446 11.3866 26.6822 177
cluster_5.pdb ( medoid) 14.5917 7.33295 14.4436 107
cluster_6.pdb ( medoid) 9.09119 8.35975 29.5601 76
cluster_7.pdb ( medoid) 7.56162 10.183 37.7491 77
cluster_8.pdb ( medoid) 7.49969 9.33372 28.9125 70
cluster_9.pdb ( medoid) 4.99753 7.20356 17.7477 36
cluster_10.pdb ( medoid) 2.3312 9.86615 19.8026 23