CABS-dock: a6e6361a500a690

Project name: a6e6361a500a690

Status: done

submitted: 2026-03-14 06:14:01, status changed: 2026-03-14 12:03:52

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRWKWKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0062	5.33196	31.3594	128
cluster_2.pdb ( medoid)	15.1551	9.10586	32.0003	138
cluster_3.pdb ( medoid)	12.5937	8.25808	21.65	104
cluster_4.pdb ( medoid)	9.99141	15.0129	34.1129	150
cluster_5.pdb ( medoid)	9.60938	10.1984	24.3735	98
cluster_6.pdb ( medoid)	9.18355	13.938	34.3305	128
cluster_7.pdb ( medoid)	6.17147	10.6944	23.51	66
cluster_8.pdb ( medoid)	4.75797	17.0241	42.8443	81
cluster_9.pdb ( medoid)	4.43106	13.3151	27.2852	59
cluster_10.pdb ( medoid)	2.85645	16.8041	32.0052	48