CABS-dock: a7d815d86afd114

Project name: a7d815d86afd114

Status: done

submitted: 2025-12-31 16:40:12, status changed: 2025-12-31 19:16:32

Project settings

Protein sequence(s)	RLRGAVTRCEDGQLFITMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYC input pdb
Peptide sequence	GYKLGVDCVPCPPGHFSPG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.5566	6.66479	25.7776	157
cluster_2.pdb ( medoid)	14.7523	13.8284	39.9463	204
cluster_3.pdb ( medoid)	13.3092	10.8947	40.2616	145
cluster_4.pdb ( medoid)	11.162	8.95897	35.1016	100
cluster_5.pdb ( medoid)	11.0126	5.90231	20.5921	65
cluster_6.pdb ( medoid)	5.86212	15.0116	44.0005	88
cluster_7.pdb ( medoid)	5.79335	15.7077	45.8139	91
cluster_8.pdb ( medoid)	4.83023	19.0467	48.6678	92
cluster_9.pdb ( medoid)	3.05206	10.4847	26.6472	32
cluster_10.pdb ( medoid)	2.08148	12.4911	36.3455	26