CABS-dock: a89df23f67e8667

Project name: a89df23f67e8667

Status: done

submitted: 2026-01-22 13:00:44, status changed: 2026-01-22 14:53:56

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	HANTAEIAESYDNRRL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.8091	1.59044	15.3989	49
cluster_2.pdb ( medoid)	25.4101	6.8083	25.1555	173
cluster_3.pdb ( medoid)	15.2005	7.63131	26.3289	116
cluster_4.pdb ( medoid)	12.3785	11.633	26.8844	144
cluster_5.pdb ( medoid)	11.0564	10.4012	22.2962	115
cluster_6.pdb ( medoid)	10.6313	11.6637	25.2591	124
cluster_7.pdb ( medoid)	9.41895	4.14059	24.298	39
cluster_8.pdb ( medoid)	8.40772	10.5855	25.5127	89
cluster_9.pdb ( medoid)	7.90661	11.8888	30.1713	94
cluster_10.pdb ( medoid)	4.97688	11.453	25.0458	57