Project name: a89df23f67e8667

Status: done

submitted: 2026-01-22 13:00:44, status changed: 2026-01-22 14:53:56

Project settings
Protein sequence(s) GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence HANTAEIAESYDNRRL
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.8091 1.59044 15.3989 49
cluster_2.pdb ( medoid) 25.4101 6.8083 25.1555 173
cluster_3.pdb ( medoid) 15.2005 7.63131 26.3289 116
cluster_4.pdb ( medoid) 12.3785 11.633 26.8844 144
cluster_5.pdb ( medoid) 11.0564 10.4012 22.2962 115
cluster_6.pdb ( medoid) 10.6313 11.6637 25.2591 124
cluster_7.pdb ( medoid) 9.41895 4.14059 24.298 39
cluster_8.pdb ( medoid) 8.40772 10.5855 25.5127 89
cluster_9.pdb ( medoid) 7.90661 11.8888 30.1713 94
cluster_10.pdb ( medoid) 4.97688 11.453 25.0458 57