CABS-dock: a8eaa705f7acc26

Project name: a8eaa705f7acc26

Status: done

submitted: 2026-01-22 13:24:46, status changed: 2026-01-22 17:35:13

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	NGSGKPIDGGPRILP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.7173	3.49959	26.4819	90
cluster_2.pdb ( medoid)	13.7707	9.94864	30.8512	137
cluster_3.pdb ( medoid)	12.1938	10.9072	43.8942	133
cluster_4.pdb ( medoid)	8.97873	9.68956	32.4765	87
cluster_5.pdb ( medoid)	7.08705	14.9569	39.469	106
cluster_6.pdb ( medoid)	6.39519	14.3858	29.8949	92
cluster_7.pdb ( medoid)	6.20697	16.7554	39.1079	104
cluster_8.pdb ( medoid)	5.74355	13.5804	41.7172	78
cluster_9.pdb ( medoid)	5.28687	3.40466	21.0168	18
cluster_10.pdb ( medoid)	3.54249	12.1383	27.9317	43