CABS-dock: PEP-95

Project name: PEP-95

Status: done

submitted: 2025-12-26 12:37:31, status changed: 2025-12-26 18:12:47

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	RNSCWSKD
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.0053	5.96561	35.3421	179
cluster_2.pdb ( medoid)	21.5922	6.39121	23.4628	138
cluster_3.pdb ( medoid)	16.305	5.58111	16.1505	91
cluster_4.pdb ( medoid)	15.2379	6.82509	30.6662	104
cluster_5.pdb ( medoid)	14.7027	9.79409	35.4437	144
cluster_6.pdb ( medoid)	8.3467	10.6629	27.1225	89
cluster_7.pdb ( medoid)	7.08983	11.0017	29.5157	78
cluster_8.pdb ( medoid)	6.70992	15.2014	31.4606	102
cluster_9.pdb ( medoid)	5.23792	11.264	30.3338	59
cluster_10.pdb ( medoid)	1.75152	9.13492	22.2318	16