Project name: a9496e5abaf92f3

Status: done

submitted: 2026-04-20 16:35:29, status changed: 2026-04-20 23:03:04

Project settings
Protein sequence(s) MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence RRKKLLPAFLLALLAL
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 43.7818 2.30689 25.73 101
cluster_2.pdb ( medoid) 21.8868 5.25432 16.1237 115
cluster_3.pdb ( medoid) 20.0672 6.1294 29.9828 123
cluster_4.pdb ( medoid) 17.6054 6.02087 37.9158 106
cluster_5.pdb ( medoid) 16.486 6.55102 39.3316 108
cluster_6.pdb ( medoid) 7.31578 9.0216 20.9314 66
cluster_7.pdb ( medoid) 5.51212 10.7037 22.7981 59
cluster_8.pdb ( medoid) 4.32267 10.4102 39.8922 45
cluster_9.pdb ( medoid) 3.7743 14.0423 41.0773 53
cluster_10.pdb ( medoid) 2.38073 10.0809 17.9495 24