Project name: GTFB_PEP

Status: done

submitted: 2026-04-05 08:41:48, status changed: 2026-04-05 18:58:35

Project settings
Protein sequence(s) MNLPQNIRYRRYQDWTEEEIKSIKTNVALSPWHTTYHIEPKTGLLNDPNGFSYFNGKFNLFYQNWPFGAAHGLKSWIHTESEDLVHFKETGTVLYPDTSHDSHGAYSGSAYEIGDQLFLFYTGNVRDENWVRHPLQIGAFMDKKGNIQKFTDVLIKQPNDVTEHFRDPQIFNYKGQFYAIVGAQSLDKKGFIKLYKAVDNDIKNWQEVGNLDFGGSKSEYMIECPNLVFINEQPVLIYSPQGLSKSELDYHNIYPNTYKVCQSFDTEKPALVDASEIQNLDFGFECYATQAFNAPDGRVYAVSWIGLPDIDYPSDSYDYQGALSLVKELSLKHGKLYQYPVEAVRSLRSEKEAVTYKPETNNTYELELTFDSSSVNELLLFADNKGNGLAITVDTKMGTILIDRSKAGEQYALEFGSQRSCSIQAKETVVNIFVDKSIFEIFINKGEKVFTGRVFPNDKQTGIVIKSGKPSGNYYELKY input pdb
Peptide sequence TQANFNTLRSLGVKGAVVKA
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHCCCCCEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.9957 5.38551 14.0394 140
cluster_2.pdb ( medoid) 23.7278 5.39451 34.6262 128
cluster_3.pdb ( medoid) 22.8146 4.82146 18.7389 110
cluster_4.pdb ( medoid) 19.0856 5.44914 17.8373 104
cluster_5.pdb ( medoid) 11.504 6.51946 22.6833 75
cluster_6.pdb ( medoid) 8.1687 14.0781 30.6685 115
cluster_7.pdb ( medoid) 6.83365 14.9261 62.5931 102
cluster_8.pdb ( medoid) 4.97603 6.83276 15.214 34
cluster_9.pdb ( medoid) 4.29972 6.27948 11.4072 27
cluster_10.pdb ( medoid) 4.29588 17.9241 33.8823 77