Project name: >jg30926.t1_2 +P27958

Status: done

submitted: 2026-02-26 07:42:20, status changed: 2026-02-26 15:23:31

Project settings
Protein sequence(s) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMKGSVVIVGRIVLSGKPAIIPKKGSVVIVGRIVLSGKPA input pdb
Peptide sequence YKVYMRHGRGFAH
Simulation mc cycles50
Peptide secondary structure psipred CCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.2808 1.74352 9.23821 65
cluster_2.pdb ( medoid) 21.9836 5.23118 27.4493 115
cluster_3.pdb ( medoid) 21.4479 9.23167 30.9242 198
cluster_4.pdb ( medoid) 17.301 8.49661 30.3768 147
cluster_5.pdb ( medoid) 15.4102 4.60733 21.8518 71
cluster_6.pdb ( medoid) 10.8781 10.5717 32.6028 115
cluster_7.pdb ( medoid) 6.67021 18.89 39.0805 126
cluster_8.pdb ( medoid) 5.90596 9.82058 22.9778 58
cluster_9.pdb ( medoid) 5.59159 14.3072 43.6511 80
cluster_10.pdb ( medoid) 2.04543 12.2224 30.4231 25