CABS-dock: aa7ca6c9843023

Project name: aa7ca6c9843023

Status: done

submitted: 2026-01-14 05:35:14, status changed: 2026-01-14 08:09:38

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIVQCFGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.087	2.7746	20.3787	114
cluster_2.pdb ( medoid)	21.5021	6.32497	28.6981	136
cluster_3.pdb ( medoid)	18.0419	9.64419	29.5312	174
cluster_4.pdb ( medoid)	17.6589	5.09657	15.9885	90
cluster_5.pdb ( medoid)	12.4758	7.1338	16.5565	89
cluster_6.pdb ( medoid)	10.9802	10.4734	32.0917	115
cluster_7.pdb ( medoid)	10.4963	5.71632	14.1507	60
cluster_8.pdb ( medoid)	9.12967	10.077	26.2339	92
cluster_9.pdb ( medoid)	7.57179	7.79208	16.1727	59
cluster_10.pdb ( medoid)	6.95758	10.2047	18.7542	71