Project name: 9ASF_EMGFKH_E2

Status: done

submitted: 2026-05-30 16:23:23, status changed: 2026-05-31 10:26:45

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence EMGFKHINHQVVPTLAVSKNKAL
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCCCCEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 91.3114 1.09515 5.03086 100
cluster_2.pdb ( medoid) 57.0854 3.57359 18.3102 204
cluster_3.pdb ( medoid) 37.1048 3.69224 10.0571 137
cluster_4.pdb ( medoid) 24.1256 4.39367 13.1508 106
cluster_5.pdb ( medoid) 9.93545 12.5812 40.855 125
cluster_6.pdb ( medoid) 5.60304 9.28068 39.6307 52
cluster_7.pdb ( medoid) 4.2038 11.6561 46.7712 49
cluster_8.pdb ( medoid) 3.74685 19.2162 53.9203 72
cluster_9.pdb ( medoid) 2.52496 18.6142 56.0725 47
cluster_10.pdb ( medoid) 0.980455 23.4585 51.0304 23