CABS-dock: CREB5_350_430_cJun_51_80

Project name: CREB5_350_430_cJun_51_80_run1

Status: done

submitted: 2026-07-16 06:05:45, status changed: 2026-07-16 08:27:20

Project settings

Protein sequence(s)	MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence	KNSDLLTSPDVGLLKLASPELERLIIQSSN
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCCCCCCHHHCCCHHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.2793	8.92149	28.075	172
cluster_2.pdb ( medoid)	18.9049	6.61205	32.0867	125
cluster_3.pdb ( medoid)	14.5528	6.66537	20.5133	97
cluster_4.pdb ( medoid)	11.8976	9.49772	22.6547	113
cluster_5.pdb ( medoid)	10.6238	11.013	27.6401	117
cluster_6.pdb ( medoid)	9.27687	12.5042	30.084	116
cluster_7.pdb ( medoid)	6.46968	14.0656	26.988	91
cluster_8.pdb ( medoid)	5.95843	11.0767	27.9127	66
cluster_9.pdb ( medoid)	4.41215	11.7856	25.1832	52
cluster_10.pdb ( medoid)	2.73349	18.6575	36.6996	51