CABS-dock: docking 2ai8 p3

Project name: docking 2ai8 p3

Status: done

submitted: 2025-12-23 02:00:32, status changed: 2025-12-23 06:18:59

Project settings

Protein sequence(s)	SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKA input pdb
Peptide sequence	VLPNTVPAK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.2723	5.81663	26.5206	147
cluster_2.pdb ( medoid)	22.1191	5.78685	18.6359	128
cluster_3.pdb ( medoid)	21.738	5.75031	22.7751	125
cluster_4.pdb ( medoid)	15.1413	5.3496	10.8828	81
cluster_5.pdb ( medoid)	14.2751	9.52708	22.3612	136
cluster_6.pdb ( medoid)	11.7394	5.19616	10.467	61
cluster_7.pdb ( medoid)	10.8516	10.1368	30.0805	110
cluster_8.pdb ( medoid)	7.52247	12.8947	32.7192	97
cluster_9.pdb ( medoid)	7.26756	7.70547	24.8109	56
cluster_10.pdb ( medoid)	5.02689	11.7369	25.9431	59