Project name: ac418907021ed7b

Status: done

submitted: 2026-03-18 05:36:34, status changed: 2026-03-18 10:11:19

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRRVQLFGDNAYRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.631 6.60192 26.8627 123
cluster_2.pdb ( medoid) 18.0531 8.03186 27.0803 145
cluster_3.pdb ( medoid) 13.4688 12.2505 29.508 165
cluster_4.pdb ( medoid) 12.2219 9.08209 27.7957 111
cluster_5.pdb ( medoid) 9.18922 13.3852 27.6635 123
cluster_6.pdb ( medoid) 7.76269 10.6922 26.9961 83
cluster_7.pdb ( medoid) 7.29513 10.2808 24.7118 75
cluster_8.pdb ( medoid) 5.08341 14.7539 31.2458 75
cluster_9.pdb ( medoid) 4.19024 11.2165 25.5443 47
cluster_10.pdb ( medoid) 3.83111 13.8341 29.6769 53