Project name: acacd99b9881aaa

Status: done

submitted: 2026-01-16 10:37:36, status changed: 2026-01-16 13:57:47

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIVQFVGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 15.345 5.53925 29.6863 85
cluster_2.pdb ( medoid) 13.985 10.6543 41.8996 149
cluster_3.pdb ( medoid) 11.6523 12.1006 37.0019 141
cluster_4.pdb ( medoid) 9.59191 11.9893 48.4168 115
cluster_5.pdb ( medoid) 9.57957 5.84578 20.3069 56
cluster_6.pdb ( medoid) 7.20391 9.85576 22.9146 71
cluster_7.pdb ( medoid) 6.7451 9.78488 29.7369 66
cluster_8.pdb ( medoid) 6.51707 20.5614 78.3999 134
cluster_9.pdb ( medoid) 6.26915 19.1414 57.9224 120
cluster_10.pdb ( medoid) 4.87035 12.9354 31.0642 63