CABS-dock: acc03a39bdce595

Project name: acc03a39bdce595

Status: done

submitted: 2026-03-16 08:38:47, status changed: 2026-03-17 01:31:33

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRVQVFGSNTYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.5208	3.99698	33.8521	110
cluster_2.pdb ( medoid)	16.6774	9.41395	27.658	157
cluster_3.pdb ( medoid)	15.3475	8.6659	28.9255	133
cluster_4.pdb ( medoid)	14.1544	10.2441	56.8332	145
cluster_5.pdb ( medoid)	12.6565	13.4318	41.5111	170
cluster_6.pdb ( medoid)	10.9009	9.72393	44.0358	106
cluster_7.pdb ( medoid)	7.68853	10.6652	26.9324	82
cluster_8.pdb ( medoid)	4.13185	11.6171	39.0558	48
cluster_9.pdb ( medoid)	2.09191	13.8629	32.5999	29
cluster_10.pdb ( medoid)	1.10214	18.1466	29.8336	20