CABS-dock: ace7b1361882ddb

Project name: ace7b1361882ddb

Status: done

submitted: 2026-03-15 13:53:34, status changed: 2026-03-15 17:00:18

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEECCCCCCCCEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.3166	4.97388	39.7347	111
cluster_2.pdb ( medoid)	18.5475	7.33254	33.5375	136
cluster_3.pdb ( medoid)	16.3156	9.92916	29.2248	162
cluster_4.pdb ( medoid)	12.0466	6.64086	28.0028	80
cluster_5.pdb ( medoid)	11.0998	9.63984	29.683	107
cluster_6.pdb ( medoid)	8.48387	12.3764	33.6053	105
cluster_7.pdb ( medoid)	6.12614	15.997	32.3063	98
cluster_8.pdb ( medoid)	5.53558	12.4648	24.477	69
cluster_9.pdb ( medoid)	5.44174	10.6583	21.7113	58
cluster_10.pdb ( medoid)	5.03878	14.6861	31.3572	74