CABS-dock: ad9789f847e0972

Project name: ad9789f847e0972

Status: done

submitted: 2026-01-15 09:59:55, status changed: 2026-01-15 13:17:48

Project settings

Protein sequence(s)	MGSGPIDPKELLKGLDSFLTRDGEVKSVDGIAKIFSLMKEARKMVSRCTYLNIILQTRAPEVLVKFIDVGGYKLLNSWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQS input pdb
Peptide sequence	RLSLPEIYELSQQWMEDPRGT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHHHHHCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.1927	6.29947	24.6189	165
cluster_2.pdb ( medoid)	18.7995	4.36181	23.616	82
cluster_3.pdb ( medoid)	17.8431	4.09122	17.7683	73
cluster_4.pdb ( medoid)	17.3514	6.68534	34.7095	116
cluster_5.pdb ( medoid)	16.2642	4.3654	12.2791	71
cluster_6.pdb ( medoid)	12.8149	11.6271	33.6541	149
cluster_7.pdb ( medoid)	12.4555	13.9697	36.2047	174
cluster_8.pdb ( medoid)	10.0726	7.7438	13.9839	78
cluster_9.pdb ( medoid)	6.77499	9.29891	27.6306	63
cluster_10.pdb ( medoid)	1.63834	17.7009	35.4035	29