CABS-dock: 2l8x

Project name: 2l8x

Status: done

submitted: 2025-12-12 16:04:06, status changed: 2025-12-12 19:37:25

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	RWCVYAYVRIRGVLVRYRRCW
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEEEEEEEEEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.0802	2.63782	22.5011	111
cluster_2.pdb ( medoid)	24.113	4.93511	27.5113	119
cluster_3.pdb ( medoid)	19.6832	6.90944	26.8045	136
cluster_4.pdb ( medoid)	17.2322	6.90567	35.1432	119
cluster_5.pdb ( medoid)	12.741	7.37778	24.0949	94
cluster_6.pdb ( medoid)	10.1699	11.7012	33.9602	119
cluster_7.pdb ( medoid)	10.0684	9.53482	27.6663	96
cluster_8.pdb ( medoid)	5.78353	14.524	26.6386	84
cluster_9.pdb ( medoid)	4.21187	17.0946	32.7055	72
cluster_10.pdb ( medoid)	3.60251	13.8792	35.3544	50