Project name: aee843f81955db1

Status: done

submitted: 2025-12-30 15:29:42, status changed: 2025-12-30 18:18:24

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIVQCGSNSFR
Simulation mc cycles50
Peptide secondary structure psipred CEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.185 7.20294 24.566 167
cluster_2.pdb ( medoid) 20.96 6.15457 20.6351 129
cluster_3.pdb ( medoid) 17.6971 5.87668 29.3347 104
cluster_4.pdb ( medoid) 15.7637 9.70581 26.0319 153
cluster_5.pdb ( medoid) 7.88776 13.185 27.1714 104
cluster_6.pdb ( medoid) 5.78448 13.4844 27.8554 78
cluster_7.pdb ( medoid) 5.49924 12.1835 27.8623 67
cluster_8.pdb ( medoid) 5.2769 13.0759 28.5733 69
cluster_9.pdb ( medoid) 5.25769 10.6511 22.0932 56
cluster_10.pdb ( medoid) 5.13123 14.2266 36.9933 73